collect the videos you love
collect | share | explore
Tag results for mp4
sort by: relevance | recent
Results from gallerynametakeninpennsylvania (3 out of 70)
masyn thorne and blaze austin

blaze austin

brutaltops - session 113 oral choking sailor brutes

stream or download brutaltops - session 113 oral choking sailor brutesmp4 for free now
Results from all user's collections (228 out of ~228)
vintage just us guys gay teenmp4 at streamtapecom

vintage just us guys gay teenmp4
fan sites - taking it rough romeo davis xl

taking it rough romeo davis xl
fan sites - drew valentino with collin amp josh

fan sites - drew valentino with collin amp josh
corpor8top amp aaron harley

corpor8top amp aaron harley
nicks charm amp chris cali 2

nicks charm amp chris cali 2
corpor8top with hung caleb

corpor8top with hung caleb
ch - ch 724

czech hunter 724
fansites - angel santana finn august hazel hoffman amp zach

angel santana finn august hazel hoffman amp zach
men - protein swap part 1 - trevor brooks amp matthew ellis

men - protein swap part 1 - trevor brooks amp matthew ellis
fansites - jason vario fuck vincent voraz

jason vario fuck vincent voraz
tt - luccas amp andrea

tt - luccas amp andrea
bartender bear bar sitges - koko bcn amp viktor rom

bartender bear bar sitges koko bcn viktor rom
morgxn thicke makes heath halo cum handsfree

morgxn thicke makes heath halo cum handsfree
sean xavier fucks the ginger foxxx on the ranch

sean xavier fucks the gingerfoxxx on the ranch
luke rex amp romeo davis

luke rex amp romeo davis